.
The Open Protein Structure Annotation Network
PDB Keyword
.

APC23278

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site MCSG
    Status Cloned
    Target Id APC23278
    Molecular Characteristics
    Source Salmonella typhimurium lt2
    Alias Ids TPS32388,NP_460001, 99287 TM1026 Molecular Weight 19390.05 Da.
    Residues 170 Isoelectric Point 4.15
    Sequence mclaeylisgpggmdpdieidddtydecrevlsriledaytqsgtfrrlmnyaydqelhdveqrwllgag enfgttvtdedlessegrkvialnlddtdddsipeyyesndgpqqfdttrsfihevvhalthlqdkeds nprgpvveytniilkemghtsppriayefsn
      BLAST   FFAS

    Ligand Information
    Ligands
    Metals
    Modeled
    Model TM1026
    generated 12/2008

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch