The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site MCSG
    Status Crystallized
    Target Id APC23287
    Molecular Characteristics
    Source Salmonella typhimurium lt2
    Alias Ids TPS5263,NP_460014, 99287 TM1039 Molecular Weight 14683.46 Da.
    Residues 132 Isoelectric Point 4.40
    Sequence mflkketftrgdasvalfelsglqrieylefiqkrtakydtdmdgtteadkrvaymqmaleinawlvsrs llngdssqdadtlyqsvqakwsyealdagaesvlmlsglsadkkdnasdsgnesedmtpeks
      BLAST   FFAS


    Reactions found in Metabolic Reconstruction for TM1039

    Name: imidazoleglycerol-phosphate dehydratase
    Metabolic Subsystem: Histidine Biosynthesis
    Reaction: : eig3p --> h2o + imacp
    Classification: EC:

    Ligand Information
    Model TM1039
    generated 12/2008

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch