.
The Open Protein Structure Annotation Network
PDB Keyword
.

APC23291

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site MCSG
    Status Purified
    Target Id APC23291
    Molecular Characteristics
    Source Salmonella typhimurium lt2
    Alias Ids TPS32174,NP_460021, 99287 TM1046 Molecular Weight 28034.71 Da.
    Residues 245 Isoelectric Point 5.56
    Sequence minddilaharqcapaescgyvvrtaqgeryfpcenlsaeptmyfrispedylnarnrgdivalvhshpd gkpclssadrtlqiqsgldwwlvcdnrihkfrcvphltgrqfehgvtdcytlfrdayhlagidmpdfdr eddwwsqgkslyldhleaagfyrvnpedaqpgdvliccfgsptpnhaaiycgngellhhipeqlskreg yndkwqrrthsiwrhrqwcesaftgiyndlesasasa
      BLAST   FFAS

    Ligand Information
    Ligands
    Metals
    Modeled
    Model TM1046
    generated 12/2008

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch