The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site MCSG
    Status Cloned
    Target Id APC23397
    Molecular Characteristics
    Source Salmonella typhimurium lt2
    Alias Ids TPS32311,NP_460453, 99287 TM1493 Molecular Weight 33882.13 Da.
    Residues 300 Isoelectric Point 6.98
    Sequence mrfkkhllgwlaatllfssqtqaaplvlatksfteqhilsamtvqylqkkgfqvqpqtniaavisrnamv nkqiditweytgtsliifnridkrmspqetydtvkrldaklglvwlkpadmnntyafamqrkraeseni ttisqmvakieqvrqndpdhnwmlgldlefagrsdgmkplqqayqmqldrpqirqmdpglvynavrdgl vdaglvyttdgrvkgfdlkvleddkgffpsyavtpvvrkevleanpglddalntlsgllnndvistlna qvdiehrtpqqvahqflqdkgll
      BLAST   FFAS

    Ligand Information
    Model TM1493
    generated 12/2008

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch