.
The Open Protein Structure Annotation Network
PDB Keyword
.

APC23417

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site MCSG
    Status Cloned
    Target Id APC23417
    Molecular Characteristics
    Source Salmonella typhimurium lt2
    Alias Ids TPS26114,NP_460574, 99287 TM1615 Molecular Weight 29365.23 Da.
    Residues 268 Isoelectric Point 6.08
    Sequence mswlkevigtekaviamchlralpgdpgfdtrkgmnwvidrahddlmalqnggvdavmfsnefslpyltk vrpettaamariigqlmseirvpfgvnvlwdpvasfdlamatdakfireiftgayasdfgvwdtnvget irhqhrigaghvktlfnivpeaavylgnrdvcsiakstvfnnnpdalcvsgltagartdsailkrvket vpdtvvlantgvclenveeqlciadgcvtattfkkdgvfanfvdqarvakfmekvrhirq
      BLAST   FFAS

    Pathway

    Reactions found in Metabolic Reconstruction for TM1615

    Name: H+-exporting ATPase
    Other genes that carryout this rxn:TM1616 TM1611 TM1614 TM1612 TM1609 T
    Metabolic Subsystem: Energy Metabolism
    Reaction: atp[c] + h[c] + h2o[c] --> adp[c] + h[e] + pi[c]
    Classification: EC:3.6.3.6
     
    Name: ATP synthase (10 protons for three ATP)
    Other genes that carryout this rxn:TM1616 TM1611 TM1614 TM1612 TM1609 T
    Metabolic Subsystem: Energy Metabolism
    Reaction: adp[c] + h[e] + pi[c] --> atp[c] + h[c] + h2o[c]
    Classification: EC:3.6.3.14
     
    Name: ATP synthase (four protons for one ATP)
    Other genes that carryout this rxn:TM1616 TM1611 TM1614 TM1612 TM1609 T
    Metabolic Subsystem: Energy Metabolism
    Reaction: adp[c] + h[e] + pi[c] --> atp[c] + h[c] + h2o[c]
    Classification: EC:3.6.3.14
     

    Ligand Information
    Ligands
    Metals
    Modeled
    Model TM1615
    generated 12/2008
    Transmembrane protein

    HMM_TM1615

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch