.
The Open Protein Structure Annotation Network
PDB Keyword
.

APC23420

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site MCSG
    Status Work Stopped
    Target Id APC23420
    Molecular Characteristics
    Source Salmonella typhimurium lt2
    Alias Ids TPS26172,NP_460583, 99287 TM1624 Molecular Weight 50961.84 Da.
    Residues 447 Isoelectric Point 5.58
    Sequence mantitadeirehfsqamsamyqqevpqygtllelvadvnlavlennpklheqlanadelarlnverhga irvgtaeelstlrrifaimgmypvsyydlsqagvpvhstafrpideaslsrnpfrmftsllrleliena alrqraaeilsqrdiftsrcrqlldeydeqggfsaaqaeefvretletfrwhrqatvdeetyrslhreh rliadvvcfpgchinhltprtldidrvqammpecgitpkiliegpprrevpillrqtsfkaleeqvlfv dekqgthtarfgeieqrgvaltpkgrrlydellhkagtgkdnfthqlhlrevfnafpdsefllrqqgla wfryrltpsgeahrqaihpgddpqpliergwviaqpityedflpvsaagifqsnlgdetlarshgnasr dafeqalgcavrdefslyqeaeerskrrcgll
      BLAST   FFAS

    Pathway

    Reactions found in Metabolic Reconstruction for TM1624

    Name: hydrolysis of galactomannan
    Other genes that carryout this rxn:TM1751 TM1752 TM1192
    Metabolic Subsystem: Mannan Metabolism
    Reaction: : galman6 + h2o --> gal + man
    Classification: EC:3.2.1.4
     
    Name: mannase
    Metabolic Subsystem: Mannan Metabolism
    Reaction: : h2o + manb --> man

     
    Name: mannase
    Metabolic Subsystem: Mannan Metabolism
    Reaction: : h2o + mantr --> man + manb

     
    Name: hydrolysis of glucomannan
    Other genes that carryout this rxn:TM1751 TM1752
    Metabolic Subsystem: Mannan Metabolism
    Reaction: : glcman4 + h2o --> glc-D + man
    Classification: EC:3.2.1.4
     
    Name: hydrolysis of glucomannan
    Other genes that carryout this rxn:TM1751 TM1752
    Metabolic Subsystem: Mannan Metabolism
    Reaction: : glcman6 + h2o --> glc-D + man
    Classification: EC:3.2.1.4
     
    Name: hydrolysis of galactomannan
    Other genes that carryout this rxn:TM1751 TM1752 TM1192
    Metabolic Subsystem: Mannan Metabolism
    Reaction: : galman4 + h2o --> gal + man
    Classification: EC:3.2.1.4
     
    Name: mannase
    Metabolic Subsystem: Mannan Metabolism
    Reaction: : h2o + manttr --> man + mantr

     

    Ligand Information
    Ligands
    Metals
    Modeled
    Model TM1624
    generated 12/2008

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch