.
The Open Protein Structure Annotation Network
PDB Keyword
.

APC23421

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site MCSG
    Status Cloned
    Target Id APC23421
    Molecular Characteristics
    Source Salmonella typhimurium lt2
    Alias Ids TPS26288,NP_460588, 99287 TM1629 Molecular Weight 14388.65 Da.
    Residues 133 Isoelectric Point 9.80
    Sequence mpisickhgapfvvqhenrygsgasqssslsksirhisnsheeikfiscysangacfsnaqmlanasgrp vigyygkinkltasldnsgrifrpqhklaanicyvgnrllsapvqlgfglkhlltchsngnvr
      BLAST   FFAS

    Pathway

    Reactions found in Metabolic Reconstruction for TM1629

    Name: glucosamine-1-phosphate N-acetyltransferase
    Metabolic Subsystem: Aminosugar Metabolism
    Reaction: : accoa + gam1p --> acgam1p + coa + h
    Classification: EC:2.3.1.157
     
    Name: UDP-N-acetylglucosamine diphosphorylase
    Metabolic Subsystem: Aminosugar Metabolism
    Reaction: : acgam1p + h + utp --> ppi + uacgam
    Classification: EC:2.7.7.23
     

    Ligand Information
    Ligands
    Metals
    Modeled
    Model TM1629
    generated 12/2008

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch