.
The Open Protein Structure Annotation Network
PDB Keyword
.

APC23461

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site MCSG
    Status Cloned
    Target Id APC23461
    Molecular Characteristics
    Source Salmonella typhimurium lt2
    Alias Ids TPS26394,NP_460830, 99287 TM1873 Molecular Weight 12728.21 Da.
    Residues 117 Isoelectric Point 9.03
    Sequence mkkillpalllatsgvalaapqvitvsrfevgkdkwafnreevmltcrpgqalyvinpstlvqyplnaia eqqvaegktraqpiaviqidnpakpgekmslapfieraqklcdpsns
      BLAST   FFAS

    Pathway

    Reactions found in Metabolic Reconstruction for TM1873

    Name: Ornithine Decarboxylase
    Metabolic Subsystem: Spermidine Biosynthesis
    Reaction: : h + orn --> co2 + ptrc
    Classification: EC:4.1.1.17
     

    Ligand Information
    Ligands
    Metals
    Modeled
    Model TM1873
    generated 12/2008

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch