The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site MCSG
    Status Expressed
    Target Id APC24290
    Molecular Characteristics
    Source Salmonella typhimurium lt2
    Alias Ids TPS32851,NP_459268, 99287 TM0271 Molecular Weight 34078.14 Da.
    Residues 300 Isoelectric Point 4.76
    Sequence mkqdmwelrkiqsqgitdnaqypagtyivftaaapyiplfeqhgkddialslvrheeawwivnhsdelcc avneqvmephhrmrlndgdtiewglsswclartndesrpdvsfpqlvqssesvaeyldldwfkqqqlnp qnpfdiipvretassytgheadstlhqlyqeyqqalrpsgqekplrakpfprnedavtqdltslydkkg dtdtlqdmvagapgidaildtldttgegemhwlamesmpdilqllspelggktahseilpdltrrehri igidshyritptqkngntahekn
      BLAST   FFAS

    Ligand Information
    Transmembrane protein


    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch