.
The Open Protein Structure Annotation Network
PDB Keyword
.

APC24292

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site MCSG
    Status Cloned
    Target Id APC24292
    Molecular Characteristics
    Source Salmonella typhimurium lt2
    Alias Ids TPS26342,NP_459296, 99287 TM0298 Molecular Weight 11147.35 Da.
    Residues 93 Isoelectric Point 9.67
    Sequence mlrmdkgpefislalaewakkhavklafiqpgkpkknvfitrfnrtyrteilnsylfrtlnevweitdkg lseyncerphesrnnmipkeyrq
      BLAST   FFAS

    Pathway

    Reactions found in Metabolic Reconstruction for TM0298

    Name: mannitol dehydrogenase
    Metabolic Subsystem: Mannitol Metabolism
    Reaction: : mnl + nad <==> h + man + nadh

     

    Ligand Information
    Ligands
    Metals
    Modeled
    Model TM0298
    generated 12/2008

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch