The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site MCSG
    Status Soluble
    Target Id APC24294
    Molecular Characteristics
    Source Salmonella typhimurium lt2
    Alias Ids TPS26406,NP_459305, 99287 TM0307 Molecular Weight 15138.64 Da.
    Residues 135 Isoelectric Point 9.19
    Sequence mknfvrttllaatlagvsfgafatavpnpplpaqdpivqhlkltndqitrikklhqqletdvsqismkgi kdgalieviksgkwddaavkqqlaafsnieqqaryyrvkyyfdlskvltpeqrqqvqqdlaqale
      BLAST   FFAS


    Reactions found in Metabolic Reconstruction for TM0307

    Name: L-fucose isomerase
    Metabolic Subsystem: Carbohydrate Metabolism
    Reaction: : fuc-L <==> fcl-L
    Classification: EC:

    Ligand Information
    Model TM0307
    generated 12/2008

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch