.
The Open Protein Structure Annotation Network
PDB Keyword
.

APC24301

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site MCSG
    Status Cloned
    Target Id APC24301
    Molecular Characteristics
    Source Salmonella typhimurium lt2
    Alias Ids TPS32789,NP_459336, 99287 TM0341 Molecular Weight 29396.63 Da.
    Residues 254 Isoelectric Point 9.16
    Sequence mmdavtfrivmnetiflldkrvvfdstkmtlshgneiiriseaethlllafwhglykkediihfvwenrg gcvsessyyklinqmrndfssiglqssdivtrprvgvslsvaiepikkitslkvsdenvkgtttrenif yknkrhsvfvvltgaillallygvftiykapvrnspdsfftylgeyndyaiyktkedkvtlsevvfafn slkikiyrqngrhlyyirepnmniflqclnpvemavpkcitvkery
      BLAST   FFAS

    Ligand Information
    Ligands
    Metals

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch