.
The Open Protein Structure Annotation Network
PDB Keyword
.

APC24302

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site MCSG
    Status Cloned
    Target Id APC24302
    Molecular Characteristics
    Source Salmonella typhimurium lt2
    Alias Ids TPS26126,NP_459339, 99287 TM0344 Molecular Weight 28030.66 Da.
    Residues 247 Isoelectric Point 5.47
    Sequence msqnnylidkrvildcermtlscagesitiseserslliafyeglfkkddlinyvwgrkgvvvsdasyyk linqlrgsfdkiglkgasvvtrprvgvllsvsieplsdeaqntplpavaetevstvevrhddtiitptp gavnkkdwlyfclaallmffmmykvkgenidyftlqgsydgytfysvghdkthltdiveaysemsneih kqngkiiyyirvpntnifvqclnqldiaepkcisikery
      BLAST   FFAS

    Pathway

    Reactions found in Metabolic Reconstruction for TM0344

    Name: prephenate dehydrogenase reversible
    Metabolic Subsystem: Phenylalanine Tyrosine Tryptophan Biosynthesis
    Reaction: : nad + pphn <==> 34hpp + co2 + nadh
    Classification: EC:1.3.1.12
     

    Ligand Information
    Ligands
    Metals
    Modeled
    Model TM0344
    generated 12/2008

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch