The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site MCSG
    Status Cloned
    Target Id APC24307
    Molecular Characteristics
    Source Salmonella typhimurium lt2
    Alias Ids TPS32403,NP_459376, 99287 TM0381 Molecular Weight 26253.70 Da.
    Residues 237 Isoelectric Point 9.58
    Sequence mfmgcenggrvrgkgfliivllggigglgyrylpsyynpfaplqladppgwittfklqrltpsqcrellt aanqqglissqpvadsagecplshvvrvrdfgqvklsssflascplalrsalfveqqakpltetwmkrr ltriehlgsyacrniyhrpdarrsehasaealdvsgfqlsdgrkitvlrgwgrqetgpwlramlnasch yygnglgpdynaahanhfhlgmrgygvcr
      BLAST   FFAS

    Ligand Information
    Model TM0381
    generated 12/2008

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch