.
The Open Protein Structure Annotation Network
PDB Keyword
.

APC24354

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site MCSG
    Status Expressed
    Target Id APC24354
    Molecular Characteristics
    Source Salmonella typhimurium lt2
    Alias Ids TPS26340,NP_459702, 99287 TM0717 Molecular Weight 12336.56 Da.
    Residues 111 Isoelectric Point 9.75
    Sequence mqpksrtgqgvreqcldrarrhfsyrhgmapgprkgadmlfpqheaavagavpgrqwpeennlmtqeyae mstgrggtskcrysmgakifllllavstvaalfslyqvlty
      BLAST   FFAS

    Pathway

    Reactions found in Metabolic Reconstruction for TM0717

    Name: acetyl-CoA carboxylase
    Other genes that carryout this rxn: TM0716
    Metabolic Subsystem: Fatty Acid Synthesis
    Reaction: : accoa + atp + hco3 --> adp + h + malcoa + pi
    Classification: EC:6.4.1.2
     
    Name: Propionyl-CoA carboxylase
    Other genes that carryout this rxn: TM0716
    Metabolic Subsystem: "Valine, Leucine, and Isoleucine Metabolism"
    Reaction: : atp + hco3 + ppcoa --> adp + h + mmcoa-S + pi
    Classification: EC:6.4.1.3
     

    Ligand Information
    Ligands
    Metals
    Modeled
    Model TM0717
    generated 12/2008

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch