.
The Open Protein Structure Annotation Network
PDB Keyword
.

APC24369

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site MCSG
    Status Work Stopped
    Target Id APC24369
    Molecular Characteristics
    Source Salmonella typhimurium lt2
    Alias Ids TPS26111,NP_459846, 99287 TM0869 Molecular Weight 23209.53 Da.
    Residues 206 Isoelectric Point 9.06
    Sequence mkenavrrandpkrrekiiqatleavktygvhavthrkiaaiaqvplgsmtyyfagmdallseaftlfte nmsrqyqdffaqvtdaegacqaitemiygsqvttpdnmalmyqlyayasdkpalkivmqnwmqrsqntl aqwfdaqtaraldafiegmtlhfvtdrtplareailqmvkriagvsmschsalgnkkptnlepkwrg
      BLAST   FFAS

    Pathway

    Reactions found in Metabolic Reconstruction for TM0869

    Name: thioredoxin reductase (NADPH)
    Other genes that carryout this rxn:TM0134
    Metabolic Subsystem: Energy Metabolism
    Reaction: : h + nadph + trdox --> nadp + trdrd
    Classification: EC:1.8.1.9
     

    Ligand Information
    Ligands
    Metals
    Modeled
    Model TM0869
    generated 12/2008

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch