.
The Open Protein Structure Annotation Network
PDB Keyword
.

APC24374

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site MCSG
    Status Cloned
    Target Id APC24374
    Molecular Characteristics
    Source Salmonella typhimurium lt2
    Alias Ids TPS33052,NP_459874, 99287 TM0898 Molecular Weight 26141.44 Da.
    Residues 231 Isoelectric Point 6.12
    Sequence mfvkvgqkirelrkarkmtitqlaaltdwdvgnisrlergmqgysaqsiqkiaealqvpvselfstetds dtvnkysvlslshqrrndvyrvdvmdvsasagngnssrdfievissieyvteeaktlfghrpanqvkli nvrgdsmqgtiepgdlifvdigvnyfdgdgiyvfdfsgdlyvkrlqkiksqllvlsdnplykewqitke ememlhvcgkvllsqsqqirrha
      BLAST   FFAS

    Ligand Information
    Ligands
    Metals

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch