The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site MCSG
    Status Purified
    Target Id APC24377
    Molecular Characteristics
    Source Salmonella typhimurium lt2
    Alias Ids TPS32191,NP_459884, 99287 TM0907 Molecular Weight 22531.56 Da.
    Residues 204 Isoelectric Point 9.35
    Sequence mnelqfqqaagisaglsarwfphidaamsefgitapldqamfiaqtghesagftvlresfnysvealkkt fgkrltpyqcemlgridgrqvahqpqianlvyggrmgnkdagdgwkyrgrgliqitglenytrcgvalk ldlvanpgqlelerhaarsaawffvtkgclkysgdlvrvtqiinggqngfgdrrerfekaksvlv
      BLAST   FFAS

    Ligand Information
    Model TM0907
    generated 12/2008

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch