.
The Open Protein Structure Annotation Network
PDB Keyword
.

APC24427

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site MCSG
    Status Work Stopped
    Target Id APC24427
    Molecular Characteristics
    Source Salmonella typhimurium lt2
    Alias Ids TPS32472,NP_460290, 99287 TM1324 Molecular Weight 32599.10 Da.
    Residues 286 Isoelectric Point 5.13
    Sequence mwqaisrllseqvgegeielrnelpggevhaawhlryaghdffvkcderemlrgftaeadqlellsrskt vvvpkvwavgsdrdysflvmdylsprpldahnafilgqqlarlhqwsdqpqfgldfdnalsttpqpntw qrrwstffaeqrigwqlelaaekgitfgnidaivehvqqrlashqpqpsllhgdlwsancalgpdgpyi fdpacywgdrecdlamlplhtdqppqiydgyqsvsplpldfldrqpiyqlytllnrarlfggqhlataq kamdrllav
      BLAST   FFAS

    Ligand Information
    Ligands
    Metals
    Modeled
    Model TM1324
    generated 12/2008

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch