The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site MCSG
    Status Cloned
    Target Id APC24453
    Molecular Characteristics
    Source Salmonella typhimurium lt2
    Alias Ids TPS32909,NP_460521, 99287 TM1562 Molecular Weight 11871.89 Da.
    Residues 109 Isoelectric Point 4.64
    Sequence mnkfslatagiivaalvtsvsvnaatdttktnvtpkgmscqefvdlnpqtmapvafwvlnededfkggdy vdfqetettavplavelckknpqselskikdeikkelsk
      BLAST   FFAS

    Ligand Information

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch