The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site MCSG
    Status Selected
    Target Id APC24477.2
    Molecular Characteristics
    Source Salmonella typhimurium lt2
    Alias Ids TPS26408,NP_460713.1, 3.40.1090.10, 99287 TM1754 Molecular Weight 12739.92 Da.
    Residues 112 Isoelectric Point 6.45
    Sequence nklsaleqwvcsfrywdvlrlmdvswgrggllrgervfnhyrdimpvtdfdhcsrrfgavatnlstgrel wftegdlhlavrascsmpglmspvehngywlvdgavvnpvpv
      BLAST   FFAS


    Reactions found in Metabolic Reconstruction for TM1754

    Name: butyrate kinase
    Metabolic Subsystem: Butanoate Metabolism
    Reaction: : atp + but --> adp + butpi
    Classification: EC:

    Ligand Information
    Model TM1754
    generated 12/2008

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch