.
The Open Protein Structure Annotation Network
PDB Keyword
.

APC24485

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site MCSG
    Status Work Stopped
    Target Id APC24485
    Molecular Characteristics
    Source Salmonella typhimurium lt2
    Alias Ids TPS26118,NP_460792, 99287 TM1836 Molecular Weight 63087.73 Da.
    Residues 581 Isoelectric Point 6.52
    Sequence mkkksdgdtrnftpirfallctaillsmalllgrvawlqivtpsklvkqedmrslrevttasprgmitdr egrplavsvpvnavwadpktiiskggvgynerwqalasalhlslstlaervnsnpagrfiylarqvspq qaewidklnlpginlreesrrfypaghvaanligftnidgqgiegieksfnaqltgkpgsrlvrkdkfg hvienitevnpvpahelqlsiderlqtvtedaldnaviwnkaesgaavliniptgeilsmasypdfnpn nregaqlddfrnraisdtfepgstvkplvimtalqqgivqpdsvidthpftldghrirdvgyypeltlt gilqkssdtgvshlslampvqklmdtyksfgfgvptglgltgessgllpkrrywsdldratfafgyglm vtplqlahvyatigsfgiyrplsitkvdppvigtrvmpeelvhevehmmesvalpggggtkaavrdyri avktgtakkigddgkyvdkyvaytagvapasnprfalvvvinnpqngayyggavsapvfsqimgdvlrl envepdgmpadsdhllvmhgshvavpgs
      BLAST   FFAS

    Pathway

    Reactions found in Metabolic Reconstruction for TM1836

    Name: trehalose transport via ABC system
    Other genes that carryout this rxn:TM1837 TM1839
    Metabolic Subsystem: Transport
    Reaction: atp[c] + h2o[c] + tre[e] --> adp[c] + h[c] + pi[c] + tre[c]

     
    Name: Maltotriose transport via ABC system
    Other genes that carryout this rxn:TM1204 TM1202 TM1203 TM1837 TM1839
    Metabolic Subsystem: Transport
    Reaction: atp[c] + h2o[c] + malttr[e] --> adp[c] + h[c] + malttr[c] + pi[c]

     
    Name: maltose transport via ABC system
    Other genes that carryout this rxn:TM1837 TM1839 TM1204 TM1202 TM1203
    Metabolic Subsystem: Transport
    Reaction: atp[c] + h2o[c] + malt[e] --> adp[c] + h[c] + malt[c] + pi[c]

     

    Ligand Information
    Ligands
    Metals
    Modeled
    Model TM1836
    generated 12/2008
    Transmembrane protein

    HMM_TM1836

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch