The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site Midwest Center for Structural Genomics
    Status Crystallized
    Target Id APC25960
    Molecular Characteristics
    Source Bacillus cereus
    Alias Ids TPS5340, Molecular Weight 19515.84 Da.
    Residues 167 Isoelectric Point 9.61
    Sequence mkkiiligsggsgkstlarqlgnklnikvhhldalfwkpnwegvpreeqitvqnnlikdekwiidgnyggtmgirl naadtiifldihrticvyrafkrivkyrnktrpdmgagceerfdlqffkwiweypnakrptilkeleqlpeekkv ivlkspnevrkflehi
      BLAST   FFAS
    Ligand Information

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch