The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site MCSG
    Status Expressed
    Target Id APC4005
    Molecular Characteristics
    Source Thermotoga maritima
    Alias Ids TPS32463,AAD35101, 2336 TM0007 Molecular Weight 52344.04 Da.
    Residues 438 Isoelectric Point 5.53
    Sequence mefliyslpeevlreemlgnfsvalkliddflkkdlpllqrerliyekerierlledypftekeamekmr emfegfsegefqylmnegvldyivvegekrferrffhnlafvrseyrerlrkdersekarrilherler likgedpkryriraritlklketsskhrvwlpfpkeslqiesvkllrtshksyyispndvpqrtiyfeg edstffvefeyivrewvnhvdpervsekvagfeeflkeepphivftpklrwltqtvvgsevnpylkakr iydwitlnvrysyvkpyalyenitdfvvnnlkgdcgfqallfitmcriagvparwqsgwyinpifgsph dwalfyvepygwlpadlsfggarrdnesfrsfyfgnldgfrmvandgfmkdfdpktrfvrsdptdnqvg eaeseekrlpfestievisfeev
      BLAST   FFAS

    Ligand Information
    Model TM0007
    generated 12/2008

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch