.
The Open Protein Structure Annotation Network
PDB Keyword
.

APC4008

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site MCSG
    Status Purified
    Target Id APC4008
    Molecular Characteristics
    Source Thermotoga maritima
    Alias Ids TPS26228,AAD35106, 2336 TM0012 Molecular Weight 19957.02 Da.
    Residues 176 Isoelectric Point 5.32
    Sequence mkkfpinsdqevavlvkskeelfkelenfieengyegkkdaliqvlhkaqelfgylpadvleyisdkldv plskvygvvtfynffstkpkgkhqikvclgtacyvkgadriferfleelkvnpdeptsdgmfsvhgvrc lgacsmapvvmvdeddfygrvtpdmvpqiiskykreg
      BLAST   FFAS

    Pathway

    Reactions found in Metabolic Reconstruction for TM0012

    Name: NADH dehydrogenase
    Other genes that carryout this rxn:TM1105 TM1212 TM1214 TM1211 TM1216 T
    Metabolic Subsystem: Energy Metabolism
    Reaction: h[c] + nadh[c] + q[c] --> h[e] + nad[c] + qh2[c]
    Classification: EC:1.6.5.3
     

    Ligand Information
    Ligands
    Metals
    Modeled
    Model TM0012
    generated 12/2008

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch