.
The Open Protein Structure Annotation Network
PDB Keyword
.

APC4015

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site MCSG
    Status Purified
    Target Id APC4015
    Molecular Characteristics
    Source Thermotoga maritima
    Alias Ids TPS33004,AAD35129, 2336 TM0035 Molecular Weight 55608.99 Da.
    Residues 485 Isoelectric Point 4.46
    Sequence mesprngssrsfgpiswqqpsdwqetpplafnstgvfkgvgdgqtlnqgigvffiydagveealvyglsq daslvdqgetewkgfkgryykfegnnlsfnvqvfplgmrdlafwnfvagepadedlktlekilssidln drfkfsrwnsqdgtlkiyqngnhfegsfgektlegiviensifgwwkksdstgsvgpsrfwdgafsgkf vegklqllfsssedpfyslegttvtfenvsgkfesstveevsvtesllcrsvyentpfatdtaftpfdk rivmwsatkpfenshifkwewydpdgnlketvyyivaptietgydyydsvwgwmatdrfgedafgewkv vvyadgkkldessfklvqepemktietetfklnvpaytyyqlsegvhyfildianlifaeahyetepln gevyktpnyevnfietsmpdyqtgqnfiywvvqfpekdgqylymsfyapeddfkrleslferilnsvelk
      BLAST   FFAS

    Ligand Information
    Ligands
    Metals

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch