.
The Open Protein Structure Annotation Network
PDB Keyword
.

APC4018

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site MCSG
    Status Work Stopped
    Target Id APC4018
    Molecular Characteristics
    Source Thermotoga maritima
    Alias Ids TPS26176,AAD35133, 2336 TM0039 Molecular Weight 30307.46 Da.
    Residues 259 Isoelectric Point 6.18
    Sequence mkdvqnekdprmvplkkvgikdlhwplkvilkedgyqstvaqiscsvdlhrekrgihmsrfievlnklev itpqifeeilddlieimeakrahleihfpyfiwkespvsrkksplkvdcfveaekeknfsfkigvrtpv htlcpcskeisdygahnqrafveitvktrkfiwfedlveiaeknassplytllkrpdekfvtekayenp rfvedvardvalelekdpritwyrvyvesmesihnhnafacvekgdfvleg
      BLAST   FFAS

    Pathway

    Reactions found in Metabolic Reconstruction for TM0039

    Name: GTP cyclohydrolase I
    Metabolic Subsystem: Folate Metabolism
    Reaction: : gtp + h2o --> ahdt + for + h
    Classification: EC:3.5.4.16
     

    Ligand Information
    Ligands
    Metals
    Modeled
    Model TM0039
    generated 12/2008

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch