The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site MCSG
    Status Work Stopped
    Target Id APC4027
    Molecular Characteristics
    Source Thermotoga maritima
    Alias Ids TPS26356,AAD35149, 2336 TM0055 Molecular Weight 78624.87 Da.
    Residues 674 Isoelectric Point 6.77
    Sequence mdyrmcwleyrglpadvagklkdwfssvsilepgssvlkdeirrfsersigitprfysrplkkekyimvg rleslpikldvnlgeegfmlrtiewngskillvtgetkkalvygifdlmkrirlgediekmnvlakpka kfrmlnhwdnldgtiergyagnsiffkdnriiinqrtkdyarllasigingvvinnvnvkkrevylids iylkklkkladifreygikiylsinfaspvylggldtadpldervarwwrekargiydyipdfggflvk adsefnpgphmfgrthaeganmlaralapfggvviwrafvynclqdwrdyktdrakaaydnfkpldgqf ddnviiqikygpmdfqvrepvnplfggmektnqilelqitqeytgqqihlcflgtlwkeilefdtfakg egsyvkrivdgtlfdrenngfagvsnvgdsvnwtghdlaqanlyafgrlawnpdeeieriveewikltf gddekvlenvsymlmkshrtyekyttpfglgwmvnpghhygpnpegyeyskwgtyhranweaigvdrts rgtgytlqyhspwkeiyddintcpedlllffhrvrydhrlksgktllqtmydlhfegveeveefikkwe elkdrvspdifervkerlhmqlehakewrdvintyfyrrtgipdekgrkiyp
      BLAST   FFAS


    Reactions found in Metabolic Reconstruction for TM0055

    Name: "alpha-glucuronidase, de-branching xylan"
    Other genes that carryout this rxn:TM0434
    Metabolic Subsystem: Xylan Metabolism
    Reaction: : h2o + xylan4 <==> glcur + xyl4


    Ligand Information
    Model TM0055
    generated 12/2008

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch