.
The Open Protein Structure Annotation Network
PDB Keyword
.

APC4033

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site MCSG
    Status Work Stopped
    Target Id APC4033
    Molecular Characteristics
    Source Thermotoga maritima
    Alias Ids TPS26388,AAD35163, 2336 TM0069 Molecular Weight 41888.29 Da.
    Residues 360 Isoelectric Point 5.95
    Sequence mklvfrwygekhdtvtleqirqipgvegvvgalfdipvgevwpfeeimklketvekaglkleviesvnvh ediklglptrdryienykktirnlakagvkvvcynfmpvfdwmrtdlhkklpdgsetmeydhrliegvt pdelikrvkegsqgfvlpgwewdrleklretfelyknvdeeklfenlvyflervipvceecdvklaihp ddppwsifglpriitnkeniermlkavdspyngitfcmgslganpennipemiryfgkmgrihfahvrn lkftgeksfyetahpsfcgshdlfevmkafhdigyegyirpdhgrliwgekarpgyglydralgatyil glweaidkmkkryc
      BLAST   FFAS

    Pathway

    Reactions found in Metabolic Reconstruction for TM0069

    Name: D-mannonate hydrolyase
    Metabolic Subsystem: Glucuronate Metabolism
    Reaction: : mana <==> 2ddglcn + h2o
    Classification: EC:4.2.1.8
     

    Ligand Information
    Ligands
    Metals
    Modeled
    Model TM0069
    generated 12/2008

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch