The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site MCSG
    Status Cloned
    Target Id APC4038
    Molecular Characteristics
    Source Thermotoga maritima
    Alias Ids TPS32324,AAD35177, 2336 TM0083 Molecular Weight 95447.81 Da.
    Residues 858 Isoelectric Point 4.68
    Sequence mpdmsmfgilntaltgihahklamnivghnianastpgysrqrpvieanppiplttltqpsfplqmgtga rvktivrlrdafldvqyrqvnnrynywdtvlsnlhfieqllaepgedgirslvdnfwnafkevmsdpss taskaevvsraqqmvsqikdlygrleqlredidaeivqrvseinqmikrladlnnkirtsmmlnsppnd llderdrildelsnlaninyteaedgqitlrignqivlngstyrelralerpygkgyhelfvgnsqlil sdgklkalidlrdssivkymrkldefvlfitdslnlvhrdgfesngvttnlnffkkieafsddpsifri kgnrklemgpyhtvtglhsansqaeiegrrfnsndvvlsfdggssnvlnisagttigdlvgswnllgts lkvgthaggyrlyledstgslrnrlflslgdslsqmgfdtetkgyitikesdlsglssgvyninveyil edgtrqtetisvdlssgvnlsnieasinssshlraqiyadpstgenmlvivpdeqlnfdpsavkvlsdd dfftesnafvrnyevlkykdtlenifygqtgfdptrpftitinstdieidpavdtletlvekinekntg vladltphhslvfrasslydfdlrmmeikgpqgffeavgfvdpdgdpttfdwntsftlvsksddfttls erfkvadiltfdrapydeplnivnqfevssslatnpanlavdvgyalensdwnatsikpsgganpelle tiqnlytrkmlsngkesfyeffggvvselgveaetasnlknnteilrqeidnareevkgvsldeemanm ieyqhafsaaakvitavdqmiqtvinmvg
      BLAST   FFAS

    Ligand Information
    Model TM0083
    generated 12/2008

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch