.
The Open Protein Structure Annotation Network
PDB Keyword
.

APC4045

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site MCSG
    Status Work Stopped
    Target Id APC4045
    Molecular Characteristics
    Source Thermotoga maritima
    Alias Ids TPS26392,AAD35191, 2336 TM0097 Molecular Weight 23795.29 Da.
    Residues 205 Isoelectric Point 8.48
    Sequence mlsgsetsslntgnrigifggsfdpvhtghvlvsvytleildldrlivvpvfnpphkktvapfekrfewl kkvfegmekmevsdyekrrggvsysiftieyfseiyktkpffivgedalsyfekwyryrdilkkstlvv yprycgkpyheharrvlgdlseivfldmpivqissteirerarlgktlkgfvpeeirkevevfygg
      BLAST   FFAS

    Pathway

    Reactions found in Metabolic Reconstruction for TM0097

    Name: nicotinamide-nucleotide adenylyltransferase
    Metabolic Subsystem: NAD Metabolism
    Reaction: : atp + h + nmn <==> nad + ppi
    Classification: EC:2.7.7.1
     
    Name: nicotinate-nucleotide adenylyltransferase
    Metabolic Subsystem: NAD Metabolism
    Reaction: : atp + h + nicrnt <==> dnad + ppi
    Classification: EC:2.7.7.18
     

    Ligand Information
    Ligands
    Metals
    Modeled
    Model TM0097
    generated 12/2008

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch