.
The Open Protein Structure Annotation Network
PDB Keyword
.

APC4053

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site MCSG
    Status Cloned
    Target Id APC4053
    Molecular Characteristics
    Source Thermotoga maritima
    Alias Ids TPS32331,AAD35207, 2336 TM0113 Molecular Weight 27234.26 Da.
    Residues 239 Isoelectric Point 6.15
    Sequence mkrllvflsiflttvllfstdskvnfgeengvklvaltfddgpdvkltsavlgtlekhgvvatffvvgqr lnestrailermismgceignhswnyepldkkdpetikdyiertkdlikkytgkeprffrppnlavsdt mfdvinmpfvsgilgydwagcdrdpqkivsnvlkdirdgaiillhdvqpephpivevleilipelkkrg ygfvtlselfkrkgvnpedpvyrkkmwvyve
      BLAST   FFAS

    Ligand Information
    Ligands
    Metals
    Modeled
    Model TM0113
    generated 12/2008

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch