.
The Open Protein Structure Annotation Network
PDB Keyword
.

APC4054.3

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site MCSG
    Status Selected
    Target Id APC4054.3
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS32209,NP_227933.1, 3.20.20.70, 243274 TM0117 Molecular Weight 19743.42 Da.
    Residues 168 Isoelectric Point 9.11
    Sequence gctnacvycyasdyarryremiwkseiivkrniaevlrkdiikkkphhvfmstmcdpyqpiekeykltrr clevflefplleievmiltkstlvlrdldlfkkmrrisvglsvttdddeirkmfepnsssieervealk vlkengirtcvfispmlpmnpkklasmlk
      BLAST   FFAS

    Ligand Information
    Ligands
    Metals
    Modeled
    Model TM0117
    generated 12/2008

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch