.
The Open Protein Structure Annotation Network
PDB Keyword
.

APC4057

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site MCSG
    Status Work Stopped
    Target Id APC4057
    Molecular Characteristics
    Source Thermotoga maritima
    Alias Ids TPS32414,AAD35215, 2336 TM0121 Molecular Weight 42935.19 Da.
    Residues 368 Isoelectric Point 8.42
    Sequence mirlkvkyytsitqveqlspeererlkrveekyrfransyylslidwsdpddpirkiivpeedeleewgt ldasneksytvakglqhkypdtalflvndvcggfcrfcfrkrlfinvgaevirditpqldyirthkeit nvlltggdplllsteklekivsslreidhvqiirigskipafnpyriiddpdllkmirkystkekkiyv mtqfnhpreltreaieavnllkdagavlcnqtpllrginddpevlgelldrlsfvgvtpyyvfqnrpvs gnrkfavpieegyeiftkaisnisgvakrvryvmshrtgkieiaaltkdfivfkyhrahdeknrrkvmv ykrnpqalwfddyselleeytv
      BLAST   FFAS

    Ligand Information
    Ligands
    Metals
    Modeled
    Model TM0121
    generated 12/2008

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch