.
The Open Protein Structure Annotation Network
PDB Keyword
.

APC4059

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site MCSG
    Status Work Stopped
    Target Id APC4059
    Molecular Characteristics
    Source Thermotoga maritima
    Alias Ids TPS26286,AAD35222, 2336 TM0128 Molecular Weight 53119.43 Da.
    Residues 462 Isoelectric Point 5.63
    Sequence mfvdttlrdghqsliatrmrtedmlpaleafdrmnfhsmevwggatfdvavrflnenpwerlkkireglk ntkiqmllrgqnlvgyrhyaddvvelfikkvaeygldiirifdalndernlqksieeskkhglhvqvai sytvspvhtldyyldfarklldmgvdsicikdmaglltpkrayelvralkekfgvpvevhshcttgfap layqaayeagadffdtaispfsmgtsqptfetmyyafrgngkedfdrealkflvdhftkvrmkyieydv gmkypdsriifsqipggmysnllkqlkeqrmehlldkvleevprvqkdlgypplvtptsqivgvqafln vvygryeritnetrnyvkglygrppapidpelmrkilgdekpidcrpadllepeldktrkelgilvetd edlliavilgevgkkflrkkyeekigvdfnyleslsdftddmpvypv
      BLAST   FFAS

    Pathway

    Reactions found in Metabolic Reconstruction for TM0128

    Name: 2-dehydro-3-deoxy-phosphogluconate aldolase
    Other genes that carryout this rxn:TM0880 TM0066
    Metabolic Subsystem: Entner-Doudoroff pathway
    Reaction: : 4h2oglt <==> glx + pyr
    Classification: EC:4.1.2.14
     
    Name: oxaloacetate decarboxylase
    Other genes that carryout this rxn:TM0880
    Metabolic Subsystem: Pyruvate Met
    Reaction: : h + oaa --> co2 + pyr
    Classification: EC:4.1.1.3
     

    Ligand Information
    Ligands
    Metals
    Modeled
    Model TM0128
    generated 12/2008

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch