.
The Open Protein Structure Annotation Network
PDB Keyword
.

APC4078

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site MCSG
    Status Work Stopped
    Target Id APC4078
    Molecular Characteristics
    Source Thermotoga maritima
    Alias Ids TPS26282,AAD35260, 2336 TM0167 Molecular Weight 43251.05 Da.
    Residues 390 Isoelectric Point 5.09
    Sequence mrvvlivldsvgigempdahlygdegsntivntakavsglhlpnmaklglgnlddipgvepvkpaegiyg kmmekspgkdtttghweiagvilkkpfdlfpegfpkelieeferrtgrkvignkpasgteiikelgpih ektgalivytsadsvfqiaakkeivpleelyryceiarellnemgykvarviarpftgewpnyvrtper kdfslepegktlldvltengipvygvgkiadifagrgvtenyktkdnndgidktislmkeknhdclift nlvdfdtkyghrndpvsyakaleefdarlpeimhnlneddvlfitadhgcdpttpstdhsremvpllgy ggrlkkdvyvgiretfadlgqtiadifgvpplengtsfknliwe
      BLAST   FFAS

    Pathway

    Reactions found in Metabolic Reconstruction for TM0167

    Name: phosphopentomutase 2 (deoxyribose)
    Metabolic Subsystem: Carbohydrate Metabolism
    Reaction: : 2dr1p <==> 2dr5p
    Classification: EC:5.4.2.7
     
    Name: phosphopentomutase
    Metabolic Subsystem: Carbohydrate Metabolism
    Reaction: : r1p <==> r5p
    Classification: EC:5.4.2.7
     

    Ligand Information
    Ligands
    Metals
    Modeled
    Model TM0167
    generated 12/2008

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch