.
The Open Protein Structure Annotation Network
PDB Keyword
.

APC4089

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site MCSG
    Status Work Stopped
    Target Id APC4089
    Molecular Characteristics
    Source Thermotoga maritima
    Alias Ids TPS26210,AAD35277, 2336 TM0184 Molecular Weight 46946.21 Da.
    Residues 429 Isoelectric Point 5.38
    Sequence mrvkyfgtdgirgifgetltdelafkvgkalgeivgegkvivgkdtrvsgdsleaaisagltsmgvdvll cgilptpavalltritrsfgvvisashnppeyngikvlkggykipdemeaeiekrlengsfltrsvvgr tksfregrdmyigavlemfrdldltgemvsldlangattttarevfeflgakvevfndsqdgllinqgc gathprflaeemkngkvgftfdgdgdrviavdeernvvngdriigilavglkeegrlnsdtvvgtvmtn ggledflkekgirllrtkvgdkyvlekmlesganlggersghiiildrsttgdglitalelmrvlkrsg rklsdfakeipdypqitknvrrtermslenenlrkiveestsrgyrvvirpsgtepviritvegkdree iekiveeisrvles
      BLAST   FFAS

    Pathway

    Reactions found in Metabolic Reconstruction for TM0184

    Name: phosphoglucosamine mutase
    Metabolic Subsystem: Aminosugar Metabolism
    Reaction: : gam6p --> gam1p
    Classification: EC:5.4.2.10
     

    Ligand Information
    Ligands
    Metals
    Modeled
    Model TM0184
    generated 12/2008

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch