The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site MCSG
    Status Work Stopped
    Target Id APC4114
    Molecular Characteristics
    Source Thermotoga maritima
    Alias Ids TPS26246,AAD35331, 2336 TM0240 Molecular Weight 28812.15 Da.
    Residues 255 Isoelectric Point 5.11
    Sequence mgntvamilaggqgtrlgvlteriakpavpfggkyrlidftlsncvnsgiyrvgvltqyrphvlskhigi grpwdldrkdggveilppyvgrhesdwykgtanavyqnlefleendaelvlilsgdhvyamnyndlidy hllkeadgtiacmevpieeasrfgimitdvdgrivdfeekpakprsnlaslgiyvfnyeflkkvliede ndpnsshdfgkdviprilrenlgslyafrfdgywrdvgtlrsywean
      BLAST   FFAS


    Reactions found in Metabolic Reconstruction for TM0240

    Name: glucose-1-phosphate adenylyltransferase
    Other genes that carryout this rxn: TM0239
    Metabolic Subsystem: Glycogene synthesis
    Reaction: : atp + g1p + h --> adpglc + ppi
    Classification: EC:

    Ligand Information
    Model TM0240
    generated 12/2008

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch