.
The Open Protein Structure Annotation Network
PDB Keyword
.

APC4134

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site MCSG
    Status Purified
    Target Id APC4134
    Molecular Characteristics
    Source Thermotoga maritima
    Alias Ids TPS32162,AAD35373, 2336 TM0285 Molecular Weight 8176.86 Da.
    Residues 73 Isoelectric Point 4.64
    Sequence mkdilgktfecscgkthevpdieiletsireapdvfsdaffiadlntaslvdlpgkrsfvfnerrplatm env
      BLAST   FFAS

    Ligand Information
    Ligands
    Metals
    Modeled
    Model TM0285
    generated 12/2008

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch