.
The Open Protein Structure Annotation Network
PDB Keyword
.

APC4152

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site MCSG
    Status Work Stopped
    Target Id APC4152
    Molecular Characteristics
    Source Thermotoga maritima
    Alias Ids TPS26264,AAD35421, 2336 TM0334 Molecular Weight 24473.15 Da.
    Residues 217 Isoelectric Point 6.25
    Sequence merllltkkktirvnedtwivlfeeridfspgqfvmletpklvrkpfvlgywedhtaisvqvkgkgtkwi veeaekikghgplgngfekpgkglliisptcltmaeafrkkmnvdvlvgsrtpfqipldhetavgdeef lsklsstgeydwylvsgsrgmekvcwehlkgkevyfsleeymgcgigackscavftkegvkhvctdgpi frgdelcws
      BLAST   FFAS

    Pathway

    Reactions found in Metabolic Reconstruction for TM0334

    Name: dihydoorotic acid dehydrogenase
    Other genes that carryout this rxn:TM0333
    Metabolic Subsystem: Pyrimidine Biosynthesis
    Reaction: : dhor-S + nad <==> nadh + orot
    Classification: EC:1.3.3.1
     

    Ligand Information
    Ligands
    Metals
    Modeled
    Model TM0334
    generated 12/2008

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch