.
The Open Protein Structure Annotation Network
PDB Keyword
.

APC4161

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site MCSG
    Status Work Stopped
    Target Id APC4161
    Molecular Characteristics
    Source Thermotoga maritima
    Alias Ids TPS26226,AAD35432, 2336 TM0346 Molecular Weight 28887.10 Da.
    Residues 253 Isoelectric Point 6.92
    Sequence mkfciigypvrhsisprlyneyfkragmnhsygmeeippesfdteirrileeydgfnatiphkervmryv epsedaqrikavncvfrgkgyntdwvgvvkslegvevkepvvvvgaggaaraviyallqmgvkdiwvvn rtierakaldfpvkifsldqldevvkkakslfnttsvgmkgeelpvsddslknlslvydviyfdtplvv karklgvkhiikgnlmfyyqamenlkiwgiydeevfkevfgevlk
      BLAST   FFAS

    Pathway

    Reactions found in Metabolic Reconstruction for TM0346

    Name: shikimate dehydrogenase
    Metabolic Subsystem: Chorismate Biosynthesis
    Reaction: : 3dhsk + h + nadph <==> nadp + skm
    Classification: EC:1.1.1.25
     

    Ligand Information
    Ligands
    Metals
    Modeled
    Model TM0346
    generated 12/2008

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch