The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site MCSG
    Status Cloned
    Target Id APC4178
    Molecular Characteristics
    Source Thermotoga maritima
    Alias Ids TPS26378,AAD35470, 2336 TM0385 Molecular Weight 75577.66 Da.
    Residues 651 Isoelectric Point 5.85
    Sequence mkvqysferefeelmsdllskygyemfqmdglgdqldvvkftedfvrrgiiestidananvrvtnistyf ieiskphtylyslyriwqkmkemfgkgvadefveaqingavylhdrhhaalmpycfaytlkpivekglp fiktiksepakhlstfiqhviqfvmfasnqssgavglpdffvwmwyfvkkdlkegiiprdkldwyieqh fqiltyslnqpirttqspytnftyldrnyikaifegerypdgslitdhvediialqkhywewvsrerer qmftfpvltasllykdgkfldedsarfinkinmkwqdtnwyisdsidavasccrltsstqtlkkfslss eeeeklkgrmnsiggsdlnigsfkvitvnlprialesggdrekylqilrhrvqlikkalaavreiiker isegllplyenglmllnrqygtigvtgvwesasimglttedidglkyteegevfvdnvldtireeaekg yheygftfnieqvpaekaavtlaqkdrflfgekqpfeiysnqwvplmantdvlnrirysgkwdkkvsgg ailhinlgesfkteeesfnmvkmiadmgvmyfafntkisvcedghafygercpvcgkakvdeymrivgy lvpvsafnkerreieyprrqfydsltirr
      BLAST   FFAS


    Reactions found in Metabolic Reconstruction for TM0385

    Name: ribonucleoside-triphosphate reductase (GTP)
    Metabolic Subsystem: Purine Metabolism
    Reaction: : gtp + trdrd --> dgtp + h2o + trdox
    Classification: EC:
    Name: ribonucleoside-triphosphate reductase (ATP)
    Metabolic Subsystem: Purine Metabolism
    Reaction: : atp + trdrd --> datp + h2o + trdox
    Classification: EC:
    Name: ribonucleoside-triphosphate reductase (CTP)
    Metabolic Subsystem: Pyrimidine Metabolism
    Reaction: : ctp + trdrd --> dctp + h2o + trdox
    Classification: EC:
    Name: ribonucleoside-triphosphate reductase (UTP)
    Metabolic Subsystem: Pyrimidine Metabolism
    Reaction: : trdrd + utp --> dutp + h2o + trdox
    Classification: EC:

    Ligand Information
    Model TM0385
    generated 12/2008

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch