.
The Open Protein Structure Annotation Network
PDB Keyword
.

APC4186

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site MCSG
    Status Purified
    Target Id APC4186
    Molecular Characteristics
    Source Thermotoga maritima
    Alias Ids TPS26202,AAD35482, 2336 TM0397 Molecular Weight 14784.16 Da.
    Residues 130 Isoelectric Point 6.27
    Sequence makrkvppefvverddykcirclacvrvcsyganfydenanrvytentkcvgchfceaicpteaitvrkn dfdirplahwtpehligimkqaetggvlltsmgndrpyfsyfdrivlnasqvtnpsidpl
      BLAST   FFAS

    Pathway

    Reactions found in Metabolic Reconstruction for TM0397

    Name: glutamate synthase (NADPH)
    Other genes that carryout this rxn:TM1640 TM1217
    Metabolic Subsystem: Glutamate Metabolism
    Reaction: : akg + gln-L + h + nadph --> glu-L + nadp
    Classification: EC:1.4.1.13
     

    Ligand Information
    Ligands
    Metals
    Modeled
    Model TM0397
    generated 12/2008

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch