.
The Open Protein Structure Annotation Network
PDB Keyword
.

APC4189

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site MCSG
    Status Purified
    Target Id APC4189
    Molecular Characteristics
    Source Thermotoga maritima
    Alias Ids TPS26300,AAD35489, 2336 TM0404 Molecular Weight 23210.67 Da.
    Residues 201 Isoelectric Point 9.19
    Sequence mkrrlglklyyrrrghvkpsllfviqshkgefvkdrleeylnnlkiekkpdsreswdsyfmriarmvser stcvhrkvgavivkdhrilatgynqppskfphcneigcirddleinsgehqeicyalhaeqnalmqaak fgiavngatiyvthkpcsicarlivnagikrvvyekdypdpltdfffkftgvesvrfvgdem
      BLAST   FFAS

    Pathway

    Reactions found in Metabolic Reconstruction for TM0404

    Name: dCMP deaminase
    Metabolic Subsystem: Pyrimidine Metabolism
    Reaction: : dcmp + h + h2o <==> dump + nh4
    Classification: EC:3.5.4.12
     

    Ligand Information
    Ligands
    Metals
    Modeled
    Model TM0404
    generated 12/2008

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch