.
The Open Protein Structure Annotation Network
PDB Keyword
.

APC4190.2

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site MCSG
    Status Selected
    Target Id APC4190.2
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS26166,NP_228215.1, 3.40.50.970, 243274 TM0405 Molecular Weight 11425.60 Da.
    Residues 95 Isoelectric Point 8.61
    Sequence rstvyhydhlvrvlkkalqhrgisvvdvltnchtyfgryngmpephqmmeyfknntcflerpeegkikig ifreeekedfltvyrrltrkegame
      BLAST   FFAS

    Pathway

    Reactions found in Metabolic Reconstruction for TM0405

    Name: ferredoxin oxidoreductase
    Other genes that carryout this rxn: TM0406 TM1164 TM1165
    Metabolic Subsystem: Citric Acid Cycle
    Reaction: : akg + coa + fdxo-4:2 --> co2 + fdxr-4:2 + h + succoa

     

    Ligand Information
    Ligands
    Metals
    Modeled
    Model TM0405
    generated 12/2008

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch