.
The Open Protein Structure Annotation Network
PDB Keyword
.

APC4191

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site MCSG
    Status Purified
    Target Id APC4191
    Molecular Characteristics
    Source Thermotoga maritima
    Alias Ids TPS26318,AAD35491, 2336 TM0406 Molecular Weight 12073.24 Da.
    Residues 105 Isoelectric Point 5.32
    Sequence kalvyegkwvvqtqsysaqvrgdvsycdvlyddspidypeseyfdivcilhqkamdelyksvkvngvvil dqtfvknvpdfvkritrkilfvpateraisefkta
      BLAST   FFAS

    Pathway

    Reactions found in Metabolic Reconstruction for TM0406

    Name: ferredoxin oxidoreductase
    Other genes that carryout this rxn:TM0405 TM1164 TM1165
    Metabolic Subsystem: Citric Acid Cycle
    Reaction: : akg + coa + fdxo-4:2 --> co2 + fdxr-4:2 + h + succoa

     

    Ligand Information
    Ligands
    Metals
    Modeled
    Model TM0406
    generated 12/2008

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch