The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site MCSG
    Status Crystallized
    Target Id APC4194
    Molecular Characteristics
    Source Thermotoga maritima
    Alias Ids TPS4596,AAD35498, 2336 TM0413 Molecular Weight 34945.39 Da.
    Residues 311 Isoelectric Point 5.57
    Sequence merptgvyfqtmtmkqirerlkqcdliiipvgstenhgpnaptgedtflvtrmaeqvalktgctvaepiw ygyhpyhhigmpgtvpvkdeafidylvsviagfwntgfrkqillnghgqefvipiaihkfakifqvpai iinlnwyhaiqdkfktkeeggpyetpfihadevetswslalfpefmhqewavdtepkgflpeghidkag nllhrpiawyghvgggpievvaypegvvgkatlasaekakegvealldyleklvrdimerfpagklppa emlsqrpkeelealtkepltegwrnlytagnlwg
      BLAST   FFAS


    Reactions found in Metabolic Reconstruction for TM0413

    Name: Creatinine amidohydrolase
    Metabolic Subsystem: Others
    Reaction: : crtn + h2o --> creat


    Ligand Information
    Model TM0413
    generated 12/2008

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch