.
The Open Protein Structure Annotation Network
PDB Keyword
.

APC4222

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site MCSG
    Status Cloned
    Target Id APC4222
    Molecular Characteristics
    Source Thermotoga maritima
    Alias Ids TPS32853,AAD35561, 2336 TM0476 Molecular Weight 44863.97 Da.
    Residues 417 Isoelectric Point 3.74
    Sequence mkkllalflvlgllvtaafayedvvkvnvsgtgyfnayldeegidleggisdlsvsispssgsvtapati taefsidvlgtdaslskiavttdlfdltyynsdiygdgyvfyyvgdraleftpklglegisltayfadi vsetdltnatndtnnyfddavalklgvtnldlldatlfgafydtdtnnatsaygyaahlnltgkdilen lvvdlayayeatsmylveaqysksfemepvtltvspyfvysegaptyydddsvdgdgwtapwgsklvkv glkaeagvtdevtfsaeltptydldansfslpvtlalaydsdmaeanvsaswddavasatnvtidanlt vtavenltvkaaaqykvatnelgynvdtsyvygplttgfffgtlfdsnsdgtadindyftwylylkasvaf
      BLAST   FFAS

    Ligand Information
    Ligands
    Metals

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch