.
The Open Protein Structure Annotation Network
PDB Keyword
.

APC4230

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site MCSG
    Status Purified
    Target Id APC4230
    Molecular Characteristics
    Source Thermotoga maritima
    Alias Ids TPS32230,AAD35574, 2336 TM0489 Molecular Weight 18830.75 Da.
    Residues 162 Isoelectric Point 5.14
    Sequence mgtvvfswtylllgrngntkepnqedieerimelmgkfrylsanrlellekktqelrkliseantvmsrl mvkmseiererifssenggeksekmekpiipviqeqeetkveekeeeletaiekrivsmydrgfsevdi aknlgitvgevrlilqlfkrnag
      BLAST   FFAS

    Ligand Information
    Ligands
    Metals
    Modeled
    Model TM0489
    generated 12/2008

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch