.
The Open Protein Structure Annotation Network
PDB Keyword
.

APC4254

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site MCSG
    Status Crystallized
    Target Id APC4254
    Molecular Characteristics
    Source Thermotoga maritima
    Alias Ids TPS4597,AAD35625, 2336 TM0540 Molecular Weight 30552.81 Da.
    Residues 272 Isoelectric Point 6.18
    Sequence minkhvisekikkaiveanikinpeveeiieryegpfsdiikenyrvskeeklplcqdtgiveffvfigh evkleepieetlnravgevyseypfrysvvsdplferintgtntpaivhifqvkgksleirflvkgggs enltvlrmmtptsdvekvkefviehikehgakacpplhvgigiggtadkalllsklaltksfkernkdp kyaglekelekelnflgigfqglgkgitvysvhiehfpthiatlpvavsvdcylcrrgkvtfed
      BLAST   FFAS

    Pathway

    Reactions found in Metabolic Reconstruction for TM0540

    Name: fumarase
    Other genes that carryout this rxn: TM0541
    Metabolic Subsystem: Citric Acid Cycle
    Reaction: : fum + h2o <==> mal-L
    Classification: EC:4.2.1.2
     

    Ligand Information
    Ligands
    Metals
    Modeled

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch